Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Basigin (BSG), partial

Product Specifications

Product Name Alternative

5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group) ; Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor

Abbreviation

Recombinant Human BSG protein, partial

Gene Name

BSG

UniProt

P35613

Expression Region

138-321aa

Organism

Homo sapiens (Human)

Target Sequence

EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein & Coronavirus Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv1.2, CT (KCNA2, Potassium voltage-gated channel subfamily A member 2)
350709 100 µg

Kv1.2, CT (KCNA2, Potassium voltage-gated channel subfamily A member 2)

Sign In for Pricing
View Details
ZNF614, ID (ZNF614, Zinc finger protein 614) (Biotin)
MBS6367220-01 0.2 mL

ZNF614, ID (ZNF614, Zinc finger protein 614) (Biotin)

Sign In for Pricing
View Details
ZNF614, ID (ZNF614, Zinc finger protein 614) (Biotin)
MBS6367220-02 5x 0.2 mL

ZNF614, ID (ZNF614, Zinc finger protein 614) (Biotin)

Sign In for Pricing
View Details
Grayanotoxin I
MBS5787154 Inquire

Grayanotoxin I

Sign In for Pricing
View Details
Rabbit Polyclonal GRHPR Antibody [PerCP]
NBP2-97219PCP 0.1 mL

Rabbit Polyclonal GRHPR Antibody [PerCP]

Sign In for Pricing
View Details
Fgf15 Protein Vector (Rat) (pPM-C-HA)
PV268380 500 ng

Fgf15 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details