Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Golgi membrane protein 1 (GOLM1), partial

Product Specifications

Product Name Alternative

Golgi membrane protein GP73Golgi phosphoprotein 2

Abbreviation

Recombinant Human GOLM1 protein, partial

Gene Name

GOLM1

UniProt

Q8NBJ4

Expression Region

36-401aa

Organism

Homo sapiens (Human)

Target Sequence

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Unknown. Cellular response protein to viral infection.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Unknown. Cellular response protein to viral infection.

Molecular Weight

45.6 kDa

References & Citations

GP73, a novel Golgi-localized protein upregulated by viral infection.Kladney R.D., Bulla G.A., Guo L., Mason A.L., Tollefson A.E., Simon D.J., Koutoubi Z., Fimmel C.J.Gene 249:53-65 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPY2 (BPY2C) (NM_001002761) Human Over-expression Lysate
LY424154 100 µg

BPY2 (BPY2C) (NM_001002761) Human Over-expression Lysate

Sign In for Pricing
View Details
POLR2A Human Gene Knockout Kit (CRISPR)
KN216765RB 1 Kit

POLR2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calnexin (CANX) Goat Polyclonal Antibody
AB0037-200 400 µg

Calnexin (CANX) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS509336 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike Protein (NTD, His Tag)
PKSR030484-01 50 µg

Recombinant SARS-CoV-2 Spike Protein (NTD, His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike Protein (NTD, His Tag)
PKSR030484-02 1 mg

Recombinant SARS-CoV-2 Spike Protein (NTD, His Tag)

Sign In for Pricing
View Details