Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Golgi membrane protein 1 (GOLM1), partial

Product Specifications

Product Name Alternative

Golgi membrane protein GP73Golgi phosphoprotein 2

Abbreviation

Recombinant Human GOLM1 protein, partial

Gene Name

GOLM1

UniProt

Q8NBJ4

Expression Region

36-401aa

Organism

Homo sapiens (Human)

Target Sequence

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Unknown. Cellular response protein to viral infection.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Unknown. Cellular response protein to viral infection.

Molecular Weight

68.6 kDa

References & Citations

GP73, a novel Golgi-localized protein upregulated by viral infection.Kladney R.D., Bulla G.A., Guo L., Mason A.L., Tollefson A.E., Simon D.J., Koutoubi Z., Fimmel C.J.Gene 249:53-65 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPON (NOS1AP) (NM_014697) Human Over-expression Lysate
LY402366 100 µg

CAPON (NOS1AP) (NM_014697) Human Over-expression Lysate

Sign In for Pricing
View Details
Rpp21 (NM_026308) Mouse Tagged ORF Clone
MG201065 10 µg

Rpp21 (NM_026308) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Jpt2 (NM_198937) Mouse Tagged ORF Clone
MG201814 10 µg

Jpt2 (NM_198937) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Peroxiredoxin 5/PRDX5 Monoclonal Antibody
AN300395P 100 µL

Recombinant Peroxiredoxin 5/PRDX5 Monoclonal Antibody

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), CF740 conjugate, 0.1mg/mL
BNC743283-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human AGER/RAGE Protein (His Tag)
PKSH031055 100 µg

Recombinant Human AGER/RAGE Protein (His Tag)

Sign In for Pricing
View Details