Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal transducer CD24 (CD24)

Product Specifications

Product Name Alternative

Small cell lung carcinoma cluster 4 antigen; CD24

Abbreviation

Recombinant Human CD24 protein

Gene Name

CD24

UniProt

P25063

Expression Region

27-80aa

Organism

Homo sapiens (Human)

Target Sequence

SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells

Molecular Weight

32.3 kDa

References & Citations

CD24, a signal transducer modulating B cell activation responses, is a very short peptide with a glycosyl phosphatidylinositol membrane anchor.Kay R., Rosten P.M., Humphries R.K.J. Immunol. 147:1412-1416 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPP Protein Vector (Human) (pPM-C-His)
PV001452 500 ng

ALPP Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CF®633-Alpha-Bungarotoxin
CHM-413-500ug 500 µg

CF®633-Alpha-Bungarotoxin

Sign In for Pricing
View Details
PSORS1C1 Protein Vector (Human) (pPM-C-HA)
38029021 500 ng

PSORS1C1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CAPZA3 CRISPRa sgRNA lentivector (set of three targets)(Human)
15013121 3x 1.0µg DNA

CAPZA3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Impg1 Mouse qPCR Primer Pair (NM_022016)
MP206816 200 Reactions

Impg1 Mouse qPCR Primer Pair (NM_022016)

Sign In for Pricing
View Details
CD8 Recombinant Antibody, Cy5.5 Conjugated
bsm-61078R-Cy5.5 100 µL

CD8 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details