Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal transducer CD24 (CD24)

Product Specifications

Product Name Alternative

Small cell lung carcinoma cluster 4 antigen; CD24

Abbreviation

Recombinant Human CD24 protein

Gene Name

CD24

UniProt

P25063

Expression Region

27-80aa

Organism

Homo sapiens (Human)

Target Sequence

SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells

Molecular Weight

32.3 kDa

References & Citations

CD24, a signal transducer modulating B cell activation responses, is a very short peptide with a glycosyl phosphatidylinositol membrane anchor.Kay R., Rosten P.M., Humphries R.K.J. Immunol. 147:1412-1416 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human GPC4 Protein, His, E.coli-1mg
QP12034-1mg 1mg

Recombinant Human GPC4 Protein, His, E.coli-1mg

Ask
View Details
Heat Shock 70kDa Protein 8 (HSPA8) Recombinant, Bovine
154971-01 10 µg

Heat Shock 70kDa Protein 8 (HSPA8) Recombinant, Bovine

Ask
View Details
Heat Shock 70kDa Protein 8 (HSPA8) Recombinant, Bovine
154971-02 50 µg

Heat Shock 70kDa Protein 8 (HSPA8) Recombinant, Bovine

Ask
View Details
Heat Shock 70kDa Protein 8 (HSPA8) Recombinant, Bovine
154971-03 200 µg

Heat Shock 70kDa Protein 8 (HSPA8) Recombinant, Bovine

Ask
View Details
WDR61 (WD Repeat-containing Protein 61, Meiotic Recombination REC14 Protein Homolog, SKI8 Homolog, Ski8) (MaxLight 750) discontinued
135360-ML750 100 µL

WDR61 (WD Repeat-containing Protein 61, Meiotic Recombination REC14 Protein Homolog, SKI8 Homolog, Ski8) (MaxLight 750) discontinued

Ask
View Details
COPG, CT (COPG1, COPG, Coatomer subunit gamma-1, Gamma-1-coat protein) (FITC) discontinued
034116-FITC 200 µL

COPG, CT (COPG1, COPG, Coatomer subunit gamma-1, Gamma-1-coat protein) (FITC) discontinued

Ask
View Details