Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Decorin (DCN), partial

Product Specifications

Product Name Alternative

Bone proteoglycan IIPG-S2; PG40

Abbreviation

Recombinant Human DCN protein, partial

Gene Name

DCN

UniProt

P07585

Expression Region

20-359aa

Organism

Homo sapiens (Human)

Target Sequence

QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May affect the rate of fibrils formation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May affect the rate of fibrils formation.

Molecular Weight

41.7 kDa

References & Citations

Primary structure of an Extracellular domain matrix proteoglycan core protein deduced from cloned cDNA.Krusius T., Ruoslahti E.Proc. Natl. Acad. Sci. U.S.A. 83:7683-7687 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurophysin I CRISPR/Cas9 KO Plasmid (h)
sc-410922 20 µg

Neurophysin I CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
TOMM34 Mouse Monoclonal Antibody [Clone ID: OTI2A9]
TA503090 100 µL

TOMM34 Mouse Monoclonal Antibody [Clone ID: OTI2A9]

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Formyl Peptide Receptor 1 (FPR1)
MBS2135582-01 0.1 mL

APC Linked Polyclonal Antibody to Formyl Peptide Receptor 1 (FPR1)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Formyl Peptide Receptor 1 (FPR1)
MBS2135582-02 0.2 mL

APC Linked Polyclonal Antibody to Formyl Peptide Receptor 1 (FPR1)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Formyl Peptide Receptor 1 (FPR1)
MBS2135582-03 0.5 mL

APC Linked Polyclonal Antibody to Formyl Peptide Receptor 1 (FPR1)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Formyl Peptide Receptor 1 (FPR1)
MBS2135582-04 1 mL

APC Linked Polyclonal Antibody to Formyl Peptide Receptor 1 (FPR1)

Sign In for Pricing
View Details