Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Creatine kinase U-type, mitochondrial (CKMT1A)

Product Specifications

Product Name Alternative

Acidic-type mitochondrial creatine kinase ; Mia-CKUbiquitous mitochondrial creatine kinase ; U-MtCK

Abbreviation

Recombinant Human CKMT1A protein

Gene Name

CKMT1A

UniProt

P12532

Expression Region

40-417aa

Organism

Homo sapiens (Human)

Target Sequence

ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) . Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy dands, such as skeletal muscle, heart, brain and spermatozoa.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) . Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Molecular Weight

47.1 kDa

References & Citations

Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.Haas R.C., Korenfeld C., Zhang Z., Perryman B., Roman D., Strauss A.W.J. Biol. Chem. 264:2890-2897 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SAPK/JNK (Thr183/Tyr185) (Clone: A11) rabbit mAb
12-4285-20 20 µL

Phospho-SAPK/JNK (Thr183/Tyr185) (Clone: A11) rabbit mAb

Sign In for Pricing
View Details
(S, S) -Reboxetine-d5
CS-T-103779 1 Each

(S, S) -Reboxetine-d5

Sign In for Pricing
View Details
Rat Cdc42 effector protein 3 (CDC42EP3) ELISA Kit
GTR10362729 96 Well

Rat Cdc42 effector protein 3 (CDC42EP3) ELISA Kit

Sign In for Pricing
View Details
Incubator IF55plus
INC8188 1 Each

Incubator IF55plus

Sign In for Pricing
View Details
ML 352
456345-01 5 mg

ML 352

Sign In for Pricing
View Details
ML 352
456345-02 10 mg

ML 352

Sign In for Pricing
View Details