Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SPARC (SPARC)

Product Specifications

Product Name Alternative

Basement-membrane protein 40 ; BM-40Osteonectin ; ONSecreted protein acidic and rich in cysteine

Abbreviation

Recombinant Human SPARC protein

Gene Name

SPARC

UniProt

P09486

Expression Region

18-303aa

Organism

Homo sapiens (Human)

Target Sequence

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Appears to regulate cell growth through interactions with the Extracellular domain matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell mbranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca2+ with a low affinity and an EF-hand loop that binds a Ca2+ ion with a high affinity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca (2+) with a low affinity and an EF-hand loop that binds a Ca (2+) ion with a high affinity.

Molecular Weight

59.7 kDa

References & Citations

"Structure of human osteonectin based upon analysis of cDNA and genomic sequences."Villarreal X.C., Mann K.G., Long G.L.Biochemistry 28:6483-6491 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK8612
S8872-100mg 100 mg

GSK8612

Sign In for Pricing
View Details
Centaurin alpha 2 (ADAP2) (NM_018404) Human Over-expression Lysate
LS055803-100ug 100 µg

Centaurin alpha 2 (ADAP2) (NM_018404) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse IgG1, kappa (Silence) Isotype Control Antibody (MOPC21)
MBS1569961-01 0.1 mg

Mouse IgG1, kappa (Silence) Isotype Control Antibody (MOPC21)

Sign In for Pricing
View Details
Mouse IgG1, kappa (Silence) Isotype Control Antibody (MOPC21)
MBS1569961-02 1 mg

Mouse IgG1, kappa (Silence) Isotype Control Antibody (MOPC21)

Sign In for Pricing
View Details
Mouse IgG1, kappa (Silence) Isotype Control Antibody (MOPC21)
MBS1569961-03 5x 1 mg

Mouse IgG1, kappa (Silence) Isotype Control Antibody (MOPC21)

Sign In for Pricing
View Details
Human Caspase-7 ELISA Kit
MBS9428285-01 96 Tests

Human Caspase-7 ELISA Kit

Sign In for Pricing
View Details