Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C motif chemokine 11 (Scyb11), partial

Product Specifications

Product Name Alternative

Interferon-inducible T-cell alpha chemoattractant ; I-TACSmall-inducible cytokine B11

Abbreviation

Recombinant Mouse Scyb11 protein, partial

Gene Name

Scyb11

UniProt

Q9JHH5

Expression Region

22-98aa

Organism

Mus musculus (Mouse)

Target Sequence

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Chotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses (By similarity) .

Molecular Weight

12.9 kDa

References & Citations

The murine chemokine CXCL11 (IFN-inducible T cell alpha chemoattractant) is an IFN-gamma- and lipopolysaccharide-inducible glucocorticoid-attenuated response gene expressed in lung and other tissues during endotoxemia.Widney D.P., Xia Y.-R., Lusis A.J., Smith J.B.J. Immunol. 164:6322-6331 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF680 Protein Vector (Human) (pPB-C-His)
PV048205 500 ng

ZNF680 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RG202875 10 µg

Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant human Ubiquitin carboxyl-terminal hydrolase 24
P2886 100 µg

Recombinant human Ubiquitin carboxyl-terminal hydrolase 24

Sign In for Pricing
View Details
Anti-ATXN7L3 Rabbit pAb
GB114096 100 μL

Anti-ATXN7L3 Rabbit pAb

Sign In for Pricing
View Details
Selk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7452305 3x 1.0 µg

Selk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
LOC499806 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6374603 1.0 µg DNA

LOC499806 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details