Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth-regulated alpha protein (Cxcl1), partial

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1; Platelet-derived growth factor-inducible protein KCSecretory protein N51

Abbreviation

Recombinant Mouse Cxcl1 protein, partial

Gene Name

Cxcl1

UniProt

P12850

Expression Region

29-96aa

Organism

Mus musculus (Mouse)

Target Sequence

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Has chotactic activity for neutrophils. Contributes to neutrophil activation during inflammation . Hatoregulatory chokine, which, in vitro, suppresses hatopoietic progenitor cell proliferation. KC (5-72) shows a highly enhanced hatopoietic activity.1 Publication

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation (By similarity) . Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC (5-72) shows a highly enhanced hematopoietic activity.

Molecular Weight

11.5 kDa

References & Citations

The platelet-derived growth factor-inducible KC gene encodes a secretory protein related to platelet alpha-granule proteins.Oquendo P., Alberta J., Wen D., Graycar J.L., Derynck R., Stiles C.D.J. Biol. Chem. 264:4133-4137 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NALP5 Rabbit Polyclonal Antibody (HRP)
orb476392 100 µL

NALP5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Trpc6 ORF Vector (Rat) (pORF)
ORF078287 1.0 µg DNA

Trpc6 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human NF-kappa-B-repressing factor (NKRF) ELISA kit
CSB-EL015836HU-01 24 Well

Human NF-kappa-B-repressing factor (NKRF) ELISA kit

Sign In for Pricing
View Details
Human NF-kappa-B-repressing factor (NKRF) ELISA kit
CSB-EL015836HU-02 96 Well

Human NF-kappa-B-repressing factor (NKRF) ELISA kit

Sign In for Pricing
View Details
Human NF-kappa-B-repressing factor (NKRF) ELISA kit
CSB-EL015836HU-03 5x 96 Well

Human NF-kappa-B-repressing factor (NKRF) ELISA kit

Sign In for Pricing
View Details
Human NF-kappa-B-repressing factor (NKRF) ELISA kit
CSB-EL015836HU-04 10x 96 Well

Human NF-kappa-B-repressing factor (NKRF) ELISA kit

Sign In for Pricing
View Details