Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 7 (Ccl7), partial

Product Specifications

Product Name Alternative

Intercrine/chemokine MAR; CMonocyte chemoattractant protein 3Monocyte chemotactic protein 3 ; MCP-3; Protein FICSmall-inducible cytokine A7

Abbreviation

Recombinant Mouse Ccl7 protein, partial

Gene Name

Ccl7

UniProt

Q03366

Expression Region

28-97aa

Organism

Mus musculus (Mouse)

Target Sequence

PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity (By similarity) .

Molecular Weight

12.1 kDa

References & Citations

Immunoglobulin E plus antigen challenge induces a novel intercrine/chemokine in mouse mast cells.Kulmburg P.A., Huber N.E., Scheer B.J., Wrann M., Baumruker T.J. Exp. Med. 176:1773-1778 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR63 Antibody
8G349-AAT 50 µg

GPR63 Antibody

Sign In for Pricing
View Details
Human ATP5MC3 activation kit by CRISPRa
GA100360 1 Kit

Human ATP5MC3 activation kit by CRISPRa

Sign In for Pricing
View Details
C10-C16 Alkyl Ethoxylate Sulfuric Acid Sodium Salt
TRC-S224720-5G 5 g

C10-C16 Alkyl Ethoxylate Sulfuric Acid Sodium Salt

Sign In for Pricing
View Details
Human FAM86B2 activation kit by CRISPRa
GA118837 1 Kit

Human FAM86B2 activation kit by CRISPRa

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F3]
TA801009BM 100 µL

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F3]

Sign In for Pricing
View Details
CD31 (PECAM1) Human Gene Knockout Kit (CRISPR)
KN208654BN 1 Kit

CD31 (PECAM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details