Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hydrophis schistosus Basic phospholipase A2

Product Specifications

Product Name Alternative

(svPLA2) (Myotoxin) (Phosphatidylcholine 2-acylhydrolase) (Toxin VI-5) (Toxin VI:5b)

Abbreviation

Recombinant Hydrophis schistosus Basic phospholipase A2 protein

UniProt

P00610

Expression Region

1-119aa

Organism

Hydrophis schistosus (Beaked sea snake) (Enhydrina schistosa)

Target Sequence

NLVQFSYVITCANHNRRSSLDYADYGCYCGAGGSGTPVDELDRCCKIHDDCYGEAEKQGCYPKMLMYDYYCGSNGPYCRNVKKKCNRKVCDCDVAAAECFARNAYNNANYNIDTKKRCK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Snake venom phospholipase A2 (PLA2) that has several activities. It is myotoxic, has weak anticoagulant activity and inhibits neuromuscular transmission by blocking acetylcholine release from the nerve termini. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.9 kDa

References & Citations

"Structure-function relationships of phospholipases. The anticoagulant region of phospholipases A2." Kini R.M., Evans H.J. J. Biol. Chem. 262:14402-14407 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 ubiquitin-protein ligase DTX3L Antibody (PE)
orb3156692 100 µg

E3 ubiquitin-protein ligase DTX3L Antibody (PE)

Sign In for Pricing
View Details
Human LYPD1 Protein, His Tag
orb1675330-01 1 mg

Human LYPD1 Protein, His Tag

Sign In for Pricing
View Details
Human LYPD1 Protein, His Tag
orb1675330-02 100 µg

Human LYPD1 Protein, His Tag

Sign In for Pricing
View Details
Lentiviral mouse Mdm1 shRNA (UAS) - Lentiviral mouse Mdm1 shRNA (UAS) (25)
GTR15189125 1 Vial

Lentiviral mouse Mdm1 shRNA (UAS) - Lentiviral mouse Mdm1 shRNA (UAS) (25)

Sign In for Pricing
View Details
ERI2 Rabbit Polyclonal Antibody
orb1562677 100 µg

ERI2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HOXC8 siRNA (Human)
orb1866049-01 15 nmol

HOXC8 siRNA (Human)

Sign In for Pricing
View Details