Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hydrophis schistosus Basic phospholipase A2

Product Specifications

Product Name Alternative

(svPLA2) (Myotoxin) (Phosphatidylcholine 2-acylhydrolase) (Toxin VI-5) (Toxin VI:5b)

Abbreviation

Recombinant Hydrophis schistosus Basic phospholipase A2 protein

UniProt

P00610

Expression Region

1-119aa

Organism

Hydrophis schistosus (Beaked sea snake) (Enhydrina schistosa)

Target Sequence

NLVQFSYVITCANHNRRSSLDYADYGCYCGAGGSGTPVDELDRCCKIHDDCYGEAEKQGCYPKMLMYDYYCGSNGPYCRNVKKKCNRKVCDCDVAAAECFARNAYNNANYNIDTKKRCK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Snake venom phospholipase A2 (PLA2) that has several activities. It is myotoxic, has weak anticoagulant activity and inhibits neuromuscular transmission by blocking acetylcholine release from the nerve termini. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.9 kDa

References & Citations

"Structure-function relationships of phospholipases. The anticoagulant region of phospholipases A2." Kini R.M., Evans H.J. J. Biol. Chem. 262:14402-14407 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHQ1 Peptide - C-terminal region
orb2002477 100 µg

SHQ1 Peptide - C-terminal region

Sign In for Pricing
View Details
CDC2 Rabbit Polyclonal Antibody (HRP)
orb2081372 100 µL

CDC2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PTCHD1 Rabbit Polyclonal Antibody (BF488)
orb2467881 100 µL

PTCHD1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Lentiviral mouse Eif4a3 shRNA (UAS) - Lentiviral mouse Eif4a3 shRNA (UAS, GFP) (100)
GTR15238953 1 Vial

Lentiviral mouse Eif4a3 shRNA (UAS) - Lentiviral mouse Eif4a3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RHOD Rabbit Polyclonal Antibody (HRP)
orb2122229 100 µL

RHOD Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Water Bath; Thermostat Water Bath
E0531 1 Unit

Water Bath; Thermostat Water Bath

Sign In for Pricing
View Details