Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8 (CXCL8), partial

Product Specifications

Product Name Alternative

C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin; Granulocyte chemotactic protein 1 ; GCP-1Monocyte-derived neutrophil chemotactic factor ; MDNCFMonocyte-derived neutrophil-activating peptide ; MONAPNeutrophil-activating protein 1 ; NAP-1; Protein 3-10CT-cell chemotactic factor

Abbreviation

Recombinant Human CXCL8 protein, partial

Gene Name

CXCL8

UniProt

P10145

Expression Region

23-99aa

Organism

Homo sapiens (Human)

Target Sequence

AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8 (6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8 (5-77) has increased activity on neutrophil activation and IL-8 (7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8 (1-77), respectively.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8 (6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8 (5-77) has increased activity on neutrophil activation and IL-8 (7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8 (1-77), respectively.

Molecular Weight

13.0 kDa

References & Citations

Induction of mRNA for a serine protease and a beta-thromboglobulin-like protein in mitogen-stimulated human leukocytes.Schmid J., Weissmann C.J. Immunol. 139:250-256 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)
MBS2066778-01 0.1 mL

APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)
MBS2066778-02 0.2 mL

APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)
MBS2066778-03 0.5 mL

APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)
MBS2066778-04 1 mL

APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)
MBS2066778-05 5 mL

APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)
MBS2066778-06 5x 5 mL

APC-Linked Polyclonal Antibody to Lysophospholipase I (LYPLA1)

Sign In for Pricing
View Details