Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin P2 protein (PMP2)

Product Specifications

Product Name Alternative

Peripheral myelin protein 2

Abbreviation

Recombinant Human PMP2 protein

Gene Name

PMP2

UniProt

P02689

Expression Region

1-132aa

Organism

Homo sapiens (Human)

Target Sequence

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Molecular Weight

41.9 kDa

References & Citations

Isolation and sequence determination of cDNA encoding P2 protein of human peripheral myelin.Hayasaka K., Nanao K., Tahara M., Sato W., Takada G., Miura M., Uyemura K.Biochem. Biophys. Res. Commun. 181:204-207 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GTPBP4 Antibody
RC-5732-01 50 μL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
Recombinant GTPBP4 Antibody
RC-5732-02 100 µL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
Recombinant GTPBP4 Antibody
RC-5732-03 1 mL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1739), CF740 conjugate, 0.1mg/mL
BNC741739-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/1739), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Cripto 1 Antibody
RC-16014-01 50 μL

Recombinant Cripto 1 Antibody

Sign In for Pricing
View Details
Recombinant Cripto 1 Antibody
RC-16014-02 100 µL

Recombinant Cripto 1 Antibody

Sign In for Pricing
View Details