What is the catalog number for Recombinant Human Myelin protein P0 (MPZ), partial?

The catalog number for Recombinant Human Myelin protein P0 (MPZ), partial is CSB-EP014774HUe0.

What sizes are available for Recombinant Human Myelin protein P0 (MPZ), partial?

Recombinant Human Myelin protein P0 (MPZ), partial is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Myelin protein P0 (MPZ), partial come in?

Recombinant Human Myelin protein P0 (MPZ), partial is available in 3 different pack sizes.

Is Recombinant Human Myelin protein P0 (MPZ), partial in stock?

Recombinant Human Myelin protein P0 (MPZ), partial is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Myelin protein P0 (MPZ), partial?

Recombinant Human Myelin protein P0 (MPZ), partial is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Myelin protein P0 (MPZ), partial?

Estimated delivery time for Recombinant Human Myelin protein P0 (MPZ), partial is approximately 15 business day(s), depending on your location.

Recombinant Human Myelin protein P0 (MPZ), partial

Product Specifications

Product Name Alternative

Myelin peripheral protein ; MPPMyelin protein zero

Abbreviation

Recombinant Human MPZ protein, partial

Gene Name

MPZ

UniProt

P25189

Expression Region

30-156aa

Organism

Homo sapiens (Human)

Target Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Creation of an Extracellular domain mbrane face which guides the wrapping process and ultimately compacts adjacent lamellae.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction.

Molecular Weight

41.5 kDa

References & Citations

Isolation and sequence determination of cDNA encoding the major structural protein of human peripheral myelin.Hayasaka K., Nanao K., Tahara M., Sato W., Takada G., Miura M., Uyemura K.Biochem. Biophys. Res. Commun. 180:515-518 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.