Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leptin (LEP), partial

Product Specifications

Product Name Alternative

Obese proteinObesity factor

Abbreviation

Recombinant Human LEP protein, partial

Gene Name

LEP

UniProt

P41159

Expression Region

29-164aa

Organism

Homo sapiens (Human)

Target Sequence

DDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways

Molecular Weight

19 kDa

References & Citations

A leptin missense mutation associated with hypogonadism and morbid obesity.Strobel A., Issad T., Camoin L., Ozata M., Strosberg A.D.Nat. Genet. 18:213-215 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Retinoic Acid Receptor Responder 1 ELISA Kit
MBS092770-01 48 Well

Camel Retinoic Acid Receptor Responder 1 ELISA Kit

Sign In for Pricing
View Details
Camel Retinoic Acid Receptor Responder 1 ELISA Kit
MBS092770-02 96 Well

Camel Retinoic Acid Receptor Responder 1 ELISA Kit

Sign In for Pricing
View Details
Camel Retinoic Acid Receptor Responder 1 ELISA Kit
MBS092770-03 5x 96 Well

Camel Retinoic Acid Receptor Responder 1 ELISA Kit

Sign In for Pricing
View Details
Camel Retinoic Acid Receptor Responder 1 ELISA Kit
MBS092770-04 10x 96 Well

Camel Retinoic Acid Receptor Responder 1 ELISA Kit

Sign In for Pricing
View Details
Magic™ Membrane Protein Human HTR6 (5-hydroxytryptamine receptor 6) Full Length
MPC0211K Each

Magic™ Membrane Protein Human HTR6 (5-hydroxytryptamine receptor 6) Full Length

Sign In for Pricing
View Details
Carbonic Anhydrase I Recombinant Rabbit Monoclonal Antibody
orb704263-01 50 μL

Carbonic Anhydrase I Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details