Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6) (Active)

Product Specifications

Product Name Alternative

Interleukin-6; IL-6; B-cell stimulatory factor 2 (BSF-2) ; CTL differentiation factor (CDF) ; Hybridoma growth factor; Interferon beta-2 (IFN-beta-2) ; IL6 ; IFNB2

Abbreviation

Recombinant Human IL6 protein (Active)

Gene Name

IL6

UniProt

P05231

Expression Region

30-212aa

Organism

Homo sapiens (Human)

Target Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Tag

N-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.3 kDa

References & Citations

"Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes to produce immunoglobulin." Hirano T., Yasukawa K., Harada H., Taga T., Watanabe Y., Matsuda T., Kashiwamura S., Nakajima K., Koyama K., Kishimoto T. Nature 324:73-76 (1986) "Structure and expression of human B cell stimulatory factor-2 (BSF-2/IL-6) gene." Yasukawa K., Hirano T., Watanabe Y., Muratani K., Matsuda T., Nakai S., Kishimoto T. EMBO J. 6:2939-2945 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD17 Protein Vector (Mouse) (pPB-C-His)
PV154518 500 ng

ANKRD17 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
DIRA3 rabbit pAb Antibody
orb772565-01 50 μL

DIRA3 rabbit pAb Antibody

Sign In for Pricing
View Details
DIRA3 rabbit pAb Antibody
orb772565-02 100 µL

DIRA3 rabbit pAb Antibody

Sign In for Pricing
View Details
Anti-HSD17B4 Antibody
MBS8234961-01 0.03 mL

Anti-HSD17B4 Antibody

Sign In for Pricing
View Details
Anti-HSD17B4 Antibody
MBS8234961-02 0.05 mL

Anti-HSD17B4 Antibody

Sign In for Pricing
View Details
Anti-HSD17B4 Antibody
MBS8234961-03 0.1 mL

Anti-HSD17B4 Antibody

Sign In for Pricing
View Details