Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 subunit beta (IL12B)

Product Specifications

Product Name Alternative

Cytotoxic lymphocyte maturation factor 40KDA subunit ; CLMF p40IL-12 subunit p40NK cell stimulatory factor chain 2 ; NKSF2

Abbreviation

Recombinant Human IL12B protein

Gene Name

IL12B

UniProt

P29460

Expression Region

23-328aa

Organism

Homo sapiens (Human)

Target Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Molecular Weight

61.7 kDa

References & Citations

Purification to homogeneity and partial characterization of cytotoxic lymphocyte maturation factor from human B-lymphoblastoid cells.Stern A.S., Podlaski F.J., Hulmes J.D., Pan Y.C.E., Quinn P.M., Wolitzky A.G., Familletti P.C., Stremlo D.L., Truitt T., Chizzonite R., Gately M.K.Proc. Natl. Acad. Sci. U.S.A. 87:6808-6812 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (SOX10/992), CF647 conjugate, 0.1mg/mL
BNC470992-500 1x 500 µL

SOX10 (SOX10/992), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human C14orf142 (GON7) activation kit by CRISPRa
GA113579 1 Kit

Human C14orf142 (GON7) activation kit by CRISPRa

Sign In for Pricing
View Details
(R)-a-[[(4-Ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]benzeneacetic Acid
TRC-E916970-25G 25 g

(R)-a-[[(4-Ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]benzeneacetic Acid

Sign In for Pricing
View Details
PLXNB3 (NM_001163257) Human Over-expression Lysate
LY431728 100 µg

PLXNB3 (NM_001163257) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXJ3 Antibody
KC-7383-01 50 μL

FOXJ3 Antibody

Sign In for Pricing
View Details
FOXJ3 Antibody
KC-7383-02 100 µL

FOXJ3 Antibody

Sign In for Pricing
View Details