Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 beta (IL1B)

Product Specifications

Product Name Alternative

Catabolin

Abbreviation

Recombinant Human IL1B protein

Gene Name

IL1B

UniProt

P01584

Expression Region

117-269aa

Organism

Homo sapiens (Human)

Target Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.

Molecular Weight

44.4 kDa

References & Citations

Nucleotide sequence of human monocyte interleukin 1 precursor cDNA.Auron P.E., Webb A.C., Rosenwasser L.J., Mucci S.F., Rich A., Wolff S.M., Dinarello C.A.Proc. Natl. Acad. Sci. U.S.A. 81:7907-7911 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIT1 Antibody - middle region
MBS3222592-01 0.1 mL

RIT1 Antibody - middle region

Sign In for Pricing
View Details
RIT1 Antibody - middle region
MBS3222592-02 5x 0.1 mL

RIT1 Antibody - middle region

Sign In for Pricing
View Details
Gm6710 3'UTR GFP Stable Cell Line
TU158463 1.0 mL

Gm6710 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human ISL LIM Homeobox Protein 1 (ISL1) ELISA Kit
MBS4500500-01 48 Tests

Human ISL LIM Homeobox Protein 1 (ISL1) ELISA Kit

Sign In for Pricing
View Details
Human ISL LIM Homeobox Protein 1 (ISL1) ELISA Kit
MBS4500500-02 96 Tests

Human ISL LIM Homeobox Protein 1 (ISL1) ELISA Kit

Sign In for Pricing
View Details
Human ISL LIM Homeobox Protein 1 (ISL1) ELISA Kit
MBS4500500-03 5x 96 Tests

Human ISL LIM Homeobox Protein 1 (ISL1) ELISA Kit

Sign In for Pricing
View Details