Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 19 protein (FGF-19) , partial

Product Specifications

Product Name Alternative

FGF 19; FGF-19; FGF15; FGF19; FGF19_HUMAN; Fibroblast growth factor 15; Fibroblast growth factor 19

Abbreviation

Recombinant Human FGF-19 protein, partial

Gene Name

FGF-19

UniProt

O95750

Expression Region

32-216aa

Organism

Homo sapiens (Human)

Target Sequence

PHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.

Molecular Weight

47.8 kDa

References & Citations

Structure and expression of a novel human FGF, FGF-19, expressed in the fetal brain.Nishimura T., Utsunomiya Y., Hoshikawa M., Ohuchi H., Itoh N.Biochim. Biophys. Acta 1444:148-151 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human URP2 (FERMT3) activation kit by CRISPRa
GA113243 1 Kit

Human URP2 (FERMT3) activation kit by CRISPRa

Sign In for Pricing
View Details
Potassium Dichromate
TRC-P695110-1G 1 g

Potassium Dichromate

Sign In for Pricing
View Details
Bovine Haptoglobin (Hpt) ELISA Kit
RDR-Hpt-b-01 96 Tests

Bovine Haptoglobin (Hpt) ELISA Kit

Sign In for Pricing
View Details
Bovine Haptoglobin (Hpt) ELISA Kit
RDR-Hpt-b-02 48 Tests

Bovine Haptoglobin (Hpt) ELISA Kit

Sign In for Pricing
View Details
Ethyl Propargylate
TRC-E818060-25G 25 g

Ethyl Propargylate

Sign In for Pricing
View Details
Decorin (DCN) (NM_001920) Human Over-expression Lysate
LY419655 100 µg

Decorin (DCN) (NM_001920) Human Over-expression Lysate

Sign In for Pricing
View Details