Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 22 (CCL22), partial

Product Specifications

Product Name Alternative

CC chemokine STCP-1MDC (1-69) Macrophage-derived chemokine; Small-inducible cytokine A22Stimulated T-cell chemotactic protein 1

Abbreviation

Recombinant Human CCL22 protein, partial

Gene Name

CCL22

UniProt

O00626

Expression Region

25-82aa

Organism

Homo sapiens (Human)

Target Sequence

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chotactic for monocytes, dendritic cells and natural killer cells. Mild choattractant for primary activated T-lymphocytes and a potent choattractant for chronically activated T-lymphocytes but has no choattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC (3-69), MDC (5-69) and MDC (7-69) se not be active.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC (3-69), MDC (5-69) and MDC (7-69) seem not be active.

Molecular Weight

33.7 kDa

References & Citations

Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AIDA (Axin Interactor, Dorsalization-associated Protein, Axin Interaction Partner and Dorsalization Antagonist, C1orf80, FLJ12806, FLJ32421, RP11-378J18.7) (MaxLight 550)
126849-ML550 100 µL

AIDA (Axin Interactor, Dorsalization-associated Protein, Axin Interaction Partner and Dorsalization Antagonist, C1orf80, FLJ12806, FLJ32421, RP11-378J18.7) (MaxLight 550)

Ask
View Details
Myosin Phosphatase (PPP1R12A) (NM_002480) Human Mass Spec Standard
PH323540 10 µg

Myosin Phosphatase (PPP1R12A) (NM_002480) Human Mass Spec Standard

Ask
View Details
XBP1 (NM_001079539) Human Tagged ORF Clone Lentiviral Particle
RC224396L3V 200 µL

XBP1 (NM_001079539) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human Alkaline Phosphatase/ALPL MAb (Clone 388828)
MAB29091 100 µg

Human Alkaline Phosphatase/ALPL MAb (Clone 388828)

Ask
View Details
SH2B1 (SH2B Adapter Protein 1, SH2B, KIAA1299, Pro-rich, PH and SH2 Domain-containing Signaling Mediator, PSM, SH2 Domain-containing Protein 1B)
MBS6007136-01 0.1 mg

SH2B1 (SH2B Adapter Protein 1, SH2B, KIAA1299, Pro-rich, PH and SH2 Domain-containing Signaling Mediator, PSM, SH2 Domain-containing Protein 1B)

Ask
View Details
SH2B1 (SH2B Adapter Protein 1, SH2B, KIAA1299, Pro-rich, PH and SH2 Domain-containing Signaling Mediator, PSM, SH2 Domain-containing Protein 1B)
MBS6007136-02 5x 0.1 mg

SH2B1 (SH2B Adapter Protein 1, SH2B, KIAA1299, Pro-rich, PH and SH2 Domain-containing Signaling Mediator, PSM, SH2 Domain-containing Protein 1B)

Ask
View Details