Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tax1-binding protein 3 (TAX1BP3)

Product Specifications

Product Name Alternative

Glutaminase-interacting protein 3Tax interaction protein 1 ; TIP-1Tax-interacting protein 1

Abbreviation

Recombinant Human TAX1BP3 protein

Gene Name

TAX1BP3

UniProt

O14907

Expression Region

1-124aa

Organism

Homo sapiens (Human)

Target Sequence

MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.

Molecular Weight

40.7 kDa

References & Citations

The C-terminus of the HTLV-1 Tax oncoprotein mediates interaction with the PDZ domain of cellular proteins.Rousset R., Fabre S., Desbois C., Bantignies F., Jalinot P.Oncogene 16:643-654 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PSMC5 Antibody
GWB-5BB338 0.1 mg

PSMC5 Antibody

Ask
View Details
Coronavirus, SARS Associated, Envenlope Protein, aa1-76, Recombinant (Severe Acute Respiratory Syndrome) discontinued. see C7901-24
C7901-20-01 100 µg

Coronavirus, SARS Associated, Envenlope Protein, aa1-76, Recombinant (Severe Acute Respiratory Syndrome) discontinued. see C7901-24

Ask
View Details
Coronavirus, SARS Associated, Envenlope Protein, aa1-76, Recombinant (Severe Acute Respiratory Syndrome) discontinued. see C7901-24
C7901-20-02 500 µg

Coronavirus, SARS Associated, Envenlope Protein, aa1-76, Recombinant (Severe Acute Respiratory Syndrome) discontinued. see C7901-24

Ask
View Details
Rat Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit
MBS9916827-01 48 Well

Rat Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit

Ask
View Details
Rat Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit
MBS9916827-02 96 Well

Rat Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit

Ask
View Details
Rat Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit
MBS9916827-03 5x 96 Well

Rat Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit

Ask
View Details