Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphatidylserine synthase 1 (PTDSS1), partial

Product Specifications

Product Name Alternative

Serine-exchange enzyme I

Abbreviation

Recombinant Human PTDSS1 protein, partial

Gene Name

PTDSS1

UniProt

P48651

Expression Region

1-35aa

Organism

Homo sapiens (Human)

Target Sequence

MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In membranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.

Molecular Weight

31.1 kDa

References & Citations

DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Endoglin /CD105 ELISA Kit
OM622229 96 Strip Well

Bovine Endoglin /CD105 ELISA Kit

Sign In for Pricing
View Details
SALL4 Monoclonal Antibody
BT-MCA3055-01 50 µL

SALL4 Monoclonal Antibody

Sign In for Pricing
View Details
SALL4 Monoclonal Antibody
BT-MCA3055-02 100 µL

SALL4 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Elafin/Skalp  (3G9)
YF-MA14700 100 ug

Anti-Elafin/Skalp (3G9)

Sign In for Pricing
View Details
NDUFS3 Polyclonal Antibody, Cy7 Conjugated
bs-3888R-Cy7 100 µL

NDUFS3 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Anti-Phospholipase A2/PLA2G4A Antibody Picoband® Fluoro488 Conjugated
PA2047-Fluoro488 100 µg/Vial

Anti-Phospholipase A2/PLA2G4A Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details