Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphatidylserine synthase 1 (PTDSS1), partial

Product Specifications

Product Name Alternative

Serine-exchange enzyme I

Abbreviation

Recombinant Human PTDSS1 protein, partial

Gene Name

PTDSS1

UniProt

P48651

Expression Region

1-35aa

Organism

Homo sapiens (Human)

Target Sequence

MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In membranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.

Molecular Weight

31.1 kDa

References & Citations

DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOCK 7 (C-7) PE
sc-398888 PE 200 µg/mL

DOCK 7 (C-7) PE

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)
MBS1182285-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)
MBS1182285-02 0.1 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)
MBS1182285-03 0.02 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)
MBS1182285-04 0.1 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)
MBS1182285-05 0.02 mg (Baculovirus)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Shikimate kinase (aroK)

Sign In for Pricing
View Details