Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b-c1 complex subunit 10 protein (UQCR11)

Product Specifications

Product Name Alternative

Complex III subunit 10Complex III subunit XIUbiquinol-cytochrome c reductase complex 6.4KDA protein

Abbreviation

Recombinant Human UQCR11 protein

Gene Name

UQCR11

UniProt

O14957

Expression Region

1-56aa

Organism

Homo sapiens (Human)

Target Sequence

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.; FUNCTION

Molecular Weight

33.6 kDa

References & Citations

The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

2′-Iodo-dATP
JBS-NU-101 150 μL

2′-Iodo-dATP

Ask
View Details
GENLISA Human Sphingosine 1 Phosphate Receptor 2 (S1PR2) ELISA
KBH10311 1x 96 Well

GENLISA Human Sphingosine 1 Phosphate Receptor 2 (S1PR2) ELISA

Ask
View Details
Mouse Monoclonal TAF1B Antibody (OTI1A8) [DyLight 350]
NBP2-74441UV 0.1 mL

Mouse Monoclonal TAF1B Antibody (OTI1A8) [DyLight 350]

Ask
View Details
RASD2 Antibody
MBS9409505-01 0.1 mL

RASD2 Antibody

Ask
View Details
RASD2 Antibody
MBS9409505-02 5x 0.1 mL

RASD2 Antibody

Ask
View Details
anti-C9orf6
YF-PA19462 50 ul

anti-C9orf6

Ask
View Details