Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 592 (ZNF592), partial

Product Specifications

Product Name Alternative

ZNF592; KIAA0211; Zinc finger protein 592

Abbreviation

Recombinant Human ZNF592 protein, partial

Gene Name

ZNF592

UniProt

Q92610

Expression Region

1-242aa

Organism

Homo sapiens (Human)

Target Sequence

MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

May be involved in transcriptional regulation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in transcriptional regulation.

Molecular Weight

53.2 kDa

References & Citations

Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.DNA Res. 3:321-329 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Dynactin subunit 3 (DCTN3) ELISA Kit
EIA07101Bo 1 Kit

Bovine Dynactin subunit 3 (DCTN3) ELISA Kit

Sign In for Pricing
View Details
SLC25A5P7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2176608 1.0 µg DNA

SLC25A5P7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HOXC9 Polyclonal Antibody, Biotin Conjugated
A62749-100 100 µL

HOXC9 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Telithromycin (Ketek) 1mg
A11664-1 1 mg

Telithromycin (Ketek) 1mg

Sign In for Pricing
View Details
TGF beta 1 (TGFB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]
TA506585BM 100 µL

TGF beta 1 (TGFB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]

Sign In for Pricing
View Details
ABCA5 siRNA (Mouse)
orb1837157-01 15 nmol

ABCA5 siRNA (Mouse)

Sign In for Pricing
View Details