Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional adapter 3 (TADA3), partial

Product Specifications

Product Name Alternative

ADA3 homolog ; hADA3STAF54Transcriptional adapter 3-like ; ADA3-like protein

Abbreviation

Recombinant Human TADA3 protein, partial

Gene Name

TADA3

UniProt

O75528

Expression Region

1-238aa

Organism

Homo sapiens (Human)

Target Sequence

MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVD

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Molecular Weight

53.9 kDa

References & Citations

Histone-like TAFs within the PCAF histone acetylase complex.Ogryzko V.V., Kotani T., Zhang X., Schiltz R.L., Howard T., Yang X.-J., Howard B.H., Qin J., Nakatani Y.Cell 94:35-44 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADD1 (Ab-726) Antibody
MBS7132620-01 0.1 mL

ADD1 (Ab-726) Antibody

Sign In for Pricing
View Details
ADD1 (Ab-726) Antibody
MBS7132620-02 5x 0.1 mL

ADD1 (Ab-726) Antibody

Sign In for Pricing
View Details
Analytical Balance (BFU-5515)
BFU-5515 1 Unit

Analytical Balance (BFU-5515)

Sign In for Pricing
View Details
Human CD282 ELISA Kit
CEK1095 96 Tests

Human CD282 ELISA Kit

Sign In for Pricing
View Details
HHLA3 Mouse Monoclonal Antibody [Clone ID: OTI10B4]
CF811294 100 µg

HHLA3 Mouse Monoclonal Antibody [Clone ID: OTI10B4]

Sign In for Pricing
View Details
ATG3 Antibody
orb1335907 100 µg

ATG3 Antibody

Sign In for Pricing
View Details