Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 384 (ZNF384), partial

Product Specifications

Product Name Alternative

CAG repeat protein 1 CAS-interacting zinc finger protein Nuclear matrix transcription factor 4 Short name: Nuclear matrix protein 4 Trinucleotide repeat-containing gene 1 protein

Abbreviation

Recombinant Human ZNF384 protein, partial

Gene Name

ZNF384

UniProt

Q8TF68

Expression Region

1-245aa

Organism

Homo sapiens (Human)

Target Sequence

MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Transcription factor that binds the consensus DNA sequence [GC]AAAAA. Seems to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1 (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.1 kDa

References & Citations

"The finished DNA sequence of human chromosome 12."Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 Monoclonal Antibody
E-AB-22166-01 20 µL

STAT3 Monoclonal Antibody

Sign In for Pricing
View Details
STAT3 Monoclonal Antibody
E-AB-22166-02 60 µL

STAT3 Monoclonal Antibody

Sign In for Pricing
View Details
STAT3 Monoclonal Antibody
E-AB-22166-03 120 µL

STAT3 Monoclonal Antibody

Sign In for Pricing
View Details
STAT3 Monoclonal Antibody
E-AB-22166-04 200 µL

STAT3 Monoclonal Antibody

Sign In for Pricing
View Details
CD8 (C8/144B), CF488A conjugate, 0.1mg/mL
BNC880749-100 1x 100 µL

CD8 (C8/144B), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
prothymosin, alpha (PTMA) Rabbit Polyclonal Antibody
AP02227SU-N 100 µL

prothymosin, alpha (PTMA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details