Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3), partial

Product Specifications

Product Name Alternative

Arp2/3 complex 21KDA subunit ; p21-AR; C

Abbreviation

Recombinant Human ARPC3 protein, partial

Gene Name

ARPC3

UniProt

O15145

Expression Region

2-175aa

Organism

Homo sapiens (Human)

Target Sequence

PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Molecular Weight

47.1 kDa

References & Citations

Mammalian actin-related protein 2/3 complex localizes to regions of lamellipodial protrusion and is composed of evolutionarily conserved proteins.Machesky L.M., Reeves E., Wientjes F., Mattheyse F.J., Grogan A., Totty N.F., Burlingame A.L., Hsuan J.J., Segal A.W.Biochem. J. 328:105-112 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABAA Receptor Alpha 2 Antibody, Clone N399/19: ATTO 390
SMC-486D-A390 100 µg

GABAA Receptor Alpha 2 Antibody, Clone N399/19: ATTO 390

Sign In for Pricing
View Details
CCNO Protein Vector (Mouse) (pPM-C-HA)
PV162956 500 ng

CCNO Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse H3c8 shRNA (UAS) - Lentiviral mouse H3c8 shRNA (UAS, iRFP) (25)
GTR15166382 1 Vial

Lentiviral mouse H3c8 shRNA (UAS) - Lentiviral mouse H3c8 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SLC38A8 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
44175154 3x 1.0 µg DNA

SLC38A8 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Human PARP16 (NM_017851) AAV Particle
RC202846A1V 250 µL

Human PARP16 (NM_017851) AAV Particle

Sign In for Pricing
View Details
AChR Alpha9 Polyclonal Antibody
BT-AP00175-01 20 µL

AChR Alpha9 Polyclonal Antibody

Sign In for Pricing
View Details