Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3), partial

Product Specifications

Product Name Alternative

Arp2/3 complex 21KDA subunit ; p21-AR; C

Abbreviation

Recombinant Human ARPC3 protein, partial

Gene Name

ARPC3

UniProt

O15145

Expression Region

2-175aa

Organism

Homo sapiens (Human)

Target Sequence

PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Molecular Weight

47.1 kDa

References & Citations

Mammalian actin-related protein 2/3 complex localizes to regions of lamellipodial protrusion and is composed of evolutionarily conserved proteins.Machesky L.M., Reeves E., Wientjes F., Mattheyse F.J., Grogan A., Totty N.F., Burlingame A.L., Hsuan J.J., Segal A.W.Biochem. J. 328:105-112 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ML077
HY-115606 1 Each

ML077

Sign In for Pricing
View Details
MED26, ID (MED26, ARC70, CRSP7, Mediator of RNA polymerase II transcription subunit 26, Activator-recruited cofactor 70kD component, Cofactor required for Sp1 transcriptional activation subunit 7, Mediator complex subunit 26, Transcriptional coactivator CRSP70)
038323 200 µL

MED26, ID (MED26, ARC70, CRSP7, Mediator of RNA polymerase II transcription subunit 26, Activator-recruited cofactor 70kD component, Cofactor required for Sp1 transcriptional activation subunit 7, Mediator complex subunit 26, Transcriptional coactivator CRSP70)

Sign In for Pricing
View Details
RNF133 Antibody (Center)
E45R04228G-1 100 µL

RNF133 Antibody (Center)

Sign In for Pricing
View Details
CKAP2 (Cytoskeleton Associated Protein 2, DKFZp686L1238, FLJ10749, LB1, TMAP, se20-10) (MaxLight 550)
MBS6216334-01 0.1 mL

CKAP2 (Cytoskeleton Associated Protein 2, DKFZp686L1238, FLJ10749, LB1, TMAP, se20-10) (MaxLight 550)

Sign In for Pricing
View Details
CKAP2 (Cytoskeleton Associated Protein 2, DKFZp686L1238, FLJ10749, LB1, TMAP, se20-10) (MaxLight 550)
MBS6216334-02 5x 0.1 mL

CKAP2 (Cytoskeleton Associated Protein 2, DKFZp686L1238, FLJ10749, LB1, TMAP, se20-10) (MaxLight 550)

Sign In for Pricing
View Details
SUMO-2/3/4 (C-3) Alexa Fluor® 647
sc-393144 AF647 200 µg/mL

SUMO-2/3/4 (C-3) Alexa Fluor® 647

Sign In for Pricing
View Details