Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 (NDUFA2), partial

Product Specifications

Product Name Alternative

Complex I-B8 ; CI-B8NADH-ubiquinone oxidoreductase B8 subunit

Abbreviation

Recombinant Human NDUFA2 protein, partial

Gene Name

NDUFA2

UniProt

O43678

Expression Region

4-99aa

Organism

Homo sapiens (Human)

Target Sequence

AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Molecular Weight

37.6 kDa

References & Citations

Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits.Ton C., Hwang D.M., Dempsey A.A., Liew C.-C.Biochem. Biophys. Res. Commun. 241:589-594 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GINS3 (DNA replication Complex GINS Protein PSF3, GINS Complex Subunit 3, GINS3, PSF3) (MaxLight 490)
MBS6456311-01 0.1 mL

GINS3 (DNA replication Complex GINS Protein PSF3, GINS Complex Subunit 3, GINS3, PSF3) (MaxLight 490)

Ask
View Details
GINS3 (DNA replication Complex GINS Protein PSF3, GINS Complex Subunit 3, GINS3, PSF3) (MaxLight 490)
MBS6456311-02 5x 0.1 mL

GINS3 (DNA replication Complex GINS Protein PSF3, GINS Complex Subunit 3, GINS3, PSF3) (MaxLight 490)

Ask
View Details
Cy3-Linked Polyclonal Antibody to C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1)
MBS2082058-01 0.1 mL

Cy3-Linked Polyclonal Antibody to C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1)

Ask
View Details
Cy3-Linked Polyclonal Antibody to C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1)
MBS2082058-02 0.2 mL

Cy3-Linked Polyclonal Antibody to C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1)

Ask
View Details
Cy3-Linked Polyclonal Antibody to C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1)
MBS2082058-03 0.5 mL

Cy3-Linked Polyclonal Antibody to C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1)

Ask
View Details
Cy3-Linked Polyclonal Antibody to C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1)
MBS2082058-04 1 mL

Cy3-Linked Polyclonal Antibody to C1q And Tumor Necrosis Factor Related Protein 1 (C1QTNF1)

Ask
View Details