Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein eta (YWHAH), partial

Product Specifications

Product Name Alternative

Protein AS1

Abbreviation

Recombinant Human YWHAH protein, partial

Gene Name

YWHAH

UniProt

Q04917

Expression Region

4-246aa

Organism

Homo sapiens (Human)

Target Sequence

REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.

Molecular Weight

54.9 kDa

References & Citations

A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Benzoyl-5-ethylthiophene
TRC-B441910-1G 1 g

2-Benzoyl-5-ethylthiophene

Sign In for Pricing
View Details
CXCL11 Antibody (Biotin)
KB-1846-01 50 μL

CXCL11 Antibody (Biotin)

Sign In for Pricing
View Details
CXCL11 Antibody (Biotin)
KB-1846-02 100 µL

CXCL11 Antibody (Biotin)

Sign In for Pricing
View Details
CXCL11 Antibody (Biotin)
KB-1846-03 1 mL

CXCL11 Antibody (Biotin)

Sign In for Pricing
View Details
Caspase-6 (CASP6) pSer257 Rabbit Polyclonal Antibody
AP12574PU-N 400 µL

Caspase-6 (CASP6) pSer257 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C19orf61 (SMG9) Rabbit Polyclonal Antibody
TA362431 100 µL

C19orf61 (SMG9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details