Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin D (CTSD), partial

Product Specifications

Product Name Alternative

CatD; CATD_HUMAN; Cathepsin D; Cathepsin D heavy chain; CD; Ceroid lipofuscinosis neuronal 10; CLN10; CPSD; ctsd; Epididymis secretory sperm binding protein Li 130P; HEL S 130P; Lysosomal aspartyl peptidase; Lysosomal aspartyl protease; MGC2311

Abbreviation

Recombinant Human CTSD protein, partial

Gene Name

CTSD

UniProt

P07339

Expression Region

67-403aa

Organism

Homo sapiens (Human)

Target Sequence

IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation

Molecular Weight

40.8 kDa

References & Citations

Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F.J. Proteome Res. 5:3135-3144 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)
MBS2142096-01 0.1 mL

FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)
MBS2142096-02 0.2 mL

FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)
MBS2142096-03 0.5 mL

FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)
MBS2142096-04 1 mL

FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)
MBS2142096-05 5 mL

FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)
MBS2142096-06 5x 5 mL

FITC-Linked Monoclonal Antibody to Caspase 6 (CASP6)

Sign In for Pricing
View Details