Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Product Specifications

Product Name Alternative

HLA G antigen; MHC class I antigen G

Abbreviation

Recombinant Human HLA-G protein

Gene Name

HLA-G

UniProt

P17693

Expression Region

25-338aa

Organism

Homo sapiens (Human)

Target Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Involved in the presentation of foreign antigens to the immune syst. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

Molecular Weight

51.6 kDa

References & Citations

Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.Disulfide bond-mediated dimerization of HLA-G on the cell surface.Boyson J.E., Erskine R., Whitman M.C., Chiu M., Lau J.M., Koopman L.A., Valter M.M., Angelisova P., Horejsi V., Strominger J.L.Proc. Natl. Acad. Sci. U.S.A. 99:16180-16185 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Acyrthosiphon pisum secondary endosymbiont phage 1 (Bacteriophage APSE-1) 39 Polyclonal antibody
MBS9013274-01 0.05 mL

Rabbit anti-Acyrthosiphon pisum secondary endosymbiont phage 1 (Bacteriophage APSE-1) 39 Polyclonal antibody

Ask
View Details
Rabbit anti-Acyrthosiphon pisum secondary endosymbiont phage 1 (Bacteriophage APSE-1) 39 Polyclonal antibody
MBS9013274-02 0.1 mL

Rabbit anti-Acyrthosiphon pisum secondary endosymbiont phage 1 (Bacteriophage APSE-1) 39 Polyclonal antibody

Ask
View Details
Rabbit anti-Acyrthosiphon pisum secondary endosymbiont phage 1 (Bacteriophage APSE-1) 39 Polyclonal antibody
MBS9013274-03 5x 0.1 mL

Rabbit anti-Acyrthosiphon pisum secondary endosymbiont phage 1 (Bacteriophage APSE-1) 39 Polyclonal antibody

Ask
View Details
Rat Smpd2 Pre-designed siRNA Set A
SI213399A 1 Each

Rat Smpd2 Pre-designed siRNA Set A

Ask
View Details
Anti-EPHX2 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)
A134260 100 µL

Anti-EPHX2 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)

Ask
View Details
Lentiviral human FRMPD2 shRNA (UAS) - Lentiviral human FRMPD2 shRNA (UAS, iRFP) (25)
GTR15111086 1 Vial

Lentiviral human FRMPD2 shRNA (UAS) - Lentiviral human FRMPD2 shRNA (UAS, iRFP) (25)

Ask
View Details