Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Extended synaptotagmin-1 (MBC2), partial

Product Specifications

Product Name Alternative

Membrane-bound C2 domain-containing protein

Abbreviation

Recombinant Human ESYT1 protein, partial

Gene Name

ESYT1

UniProt

Q9BSJ8

Expression Region

1-245aa

Organism

Homo sapiens (Human)

Target Sequence

MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell mbrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell mbrane and promotes the formation of appositions between the endoplasmic reticulum and the cell mbrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport (By similarity) . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell membrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane.

Molecular Weight

53.7 kDa

References & Citations

E-Syts, a family of membranous Ca2+-sensor proteins with multiple C2 domains.Min S.-W., Chang W.-P., Suedhof T.C.Proc. Natl. Acad. Sci. U.S.A. 104:3823-3828 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human CNN3 shRNA Plasmid
abx950886-01 150 µg

Human CNN3 shRNA Plasmid

Ask
View Details
Human CNN3 shRNA Plasmid
abx950886-02 300 µg

Human CNN3 shRNA Plasmid

Ask
View Details
SULT1B1, CT (SULT1B1, ST1B2, SULT1B2, Sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B2, Thyroid hormone sulfotransferase) (APC)
MBS6352512-01 0.2 mL

SULT1B1, CT (SULT1B1, ST1B2, SULT1B2, Sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B2, Thyroid hormone sulfotransferase) (APC)

Ask
View Details
SULT1B1, CT (SULT1B1, ST1B2, SULT1B2, Sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B2, Thyroid hormone sulfotransferase) (APC)
MBS6352512-02 5x 0.2 mL

SULT1B1, CT (SULT1B1, ST1B2, SULT1B2, Sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B2, Thyroid hormone sulfotransferase) (APC)

Ask
View Details
MRPS30 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
30575156 3x1.0μg DNA

MRPS30 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Ask
View Details