Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Extended synaptotagmin-1 (MBC2), partial

Product Specifications

Product Name Alternative

Membrane-bound C2 domain-containing protein

Abbreviation

Recombinant Human ESYT1 protein, partial

Gene Name

ESYT1

UniProt

Q9BSJ8

Expression Region

1-245aa

Organism

Homo sapiens (Human)

Target Sequence

MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell mbrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell mbrane and promotes the formation of appositions between the endoplasmic reticulum and the cell mbrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport (By similarity) . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell membrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane.

Molecular Weight

53.7 kDa

References & Citations

E-Syts, a family of membranous Ca2+-sensor proteins with multiple C2 domains.Min S.-W., Chang W.-P., Suedhof T.C.Proc. Natl. Acad. Sci. U.S.A. 104:3823-3828 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse RPL28 Protein, His (Fc)-Avi-tagged
RPL28-7734M 50 µg

Recombinant Mouse RPL28 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
DEPDC1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV709260 1.0 µg DNA

DEPDC1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Pde12 AAV siRNA Pooled Vector
36276164 1.0 µg

Pde12 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FGF1 Polyclonal Antibody, Cy5.5 Conjugated
bs-0229R-Cy5.5 100 µL

FGF1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Apolipoprotein A I (APOA1) (NM_000039) Human Tagged ORF Clone
RC210762 10 µg

Apolipoprotein A I (APOA1) (NM_000039) Human Tagged ORF Clone

Sign In for Pricing
View Details
LPAR3 ELISA Kit (Human)
OKCD08804-96W 96 Well

LPAR3 ELISA Kit (Human)

Sign In for Pricing
View Details