Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription factor BTF3 (BTF3), partial

Product Specifications

Product Name Alternative

Nascent polypeptide-associated complex subunit beta ; NAC-betaRNA polymerase B transcription factor 3

Abbreviation

Recombinant Human BTF3 protein, partial

Gene Name

BTF3

UniProt

P20290

Expression Region

48-206aa

Organism

Homo sapiens (Human)

Target Sequence

TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

When associated with NACA, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER) . Binds to nascent polypeptide chains as they erge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. BTF3 is also a general transcription factor that can form a stable complex with RNA polymerase II. Required for the initiation of transcription.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

When associated with NACA, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER) . Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. BTF3 is also a general transcription factor that can form a stable complex with RNA polymerase II. Required for the initiation of transcription.

Molecular Weight

44.3 kDa

References & Citations

Sequencing and expression of complementary DNA for the general transcription factor BTF3.Zheng X.M., Black D., Chambon P., Egly J.-M.Nature 344:556-559 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Albumin (Biotin)
544901 200 µL

Albumin (Biotin)

Sign In for Pricing
View Details
ACSL3 (Long-Chain-Fatty-Acid--CoA Ligase 3, Acyl-CoA Synthetase Long-Chain Family Member 3)
474644 100 µL

ACSL3 (Long-Chain-Fatty-Acid--CoA Ligase 3, Acyl-CoA Synthetase Long-Chain Family Member 3)

Sign In for Pricing
View Details
DNAJB8, NT (DNAJB8, DnaJ homolog subfamily B member 8) (MaxLight 650)
MBS6292715-01 0.1 mL

DNAJB8, NT (DNAJB8, DnaJ homolog subfamily B member 8) (MaxLight 650)

Sign In for Pricing
View Details
DNAJB8, NT (DNAJB8, DnaJ homolog subfamily B member 8) (MaxLight 650)
MBS6292715-02 5x 0.1 mL

DNAJB8, NT (DNAJB8, DnaJ homolog subfamily B member 8) (MaxLight 650)

Sign In for Pricing
View Details
DMU2105
C07049 5 mg

DMU2105

Sign In for Pricing
View Details
PTK2 (phospho-S843) polyclonal antibody
orb646500-01 50 μL

PTK2 (phospho-S843) polyclonal antibody

Sign In for Pricing
View Details