Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2B type 1-C/E/F/G/I (H2BC4), partial

Product Specifications

Product Name Alternative

Histone H2B.1 AHistone H2B.a ; H2B/aHistone H2B.g ; H2B/gHistone H2B.h ; H2B/hHistone H2B.k ; H2B/kHistone H2B.l ; H2B/l

Abbreviation

Recombinant Human HIST1H2BC protein, partial

Gene Name

HIST1H2BC

UniProt

P62807

Expression Region

2-125aa

Organism

Homo sapiens (Human)

Target Sequence

PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.; FUNCTION

Molecular Weight

40.6 kDa

References & Citations

Isolation and characterization of two human H1 histone genes within clusters of core histone genes.Albig W., Kardalinou E., Drabent B., Zimmer A., Doenecke D.Genomics 10:940-948 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Tosyl-L-aspartic Acid
TRC-T585030-25G 25 g

N-Tosyl-L-aspartic Acid

Sign In for Pricing
View Details
TBC1D3C (NM_001001418) Human Recombinant Protein
TP324873L 1 mg

TBC1D3C (NM_001001418) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Testis
CR562820 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF488A conjugate, 0.1mg/mL
BNC882332-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSTU
TRC-T895560-50G 50 g

TSTU

Sign In for Pricing
View Details
NR2F2 Polyclonal Antibody
E-AB-17411-01 20 µL

NR2F2 Polyclonal Antibody

Sign In for Pricing
View Details