Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prefoldin subunit 1 (PFDN1)

Product Specifications

Product Name Alternative

PDF; PFD1; PFD1_HUMAN; pfdn1; Prefoldin 1; Prefoldin subunit 1

Abbreviation

Recombinant Human PFDN1 protein

Gene Name

PFDN1

UniProt

O60925

Expression Region

2-122aa

Organism

Homo sapiens (Human)

Target Sequence

AAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Molecular Weight

41.1 kDa

References & Citations

Prefoldin, a chaperone that delivers unfolded proteins to cytosolic chaperonin.Vainberg I.E., Lewis S.A., Rommelaere H., Ampe C., Vandekerckhove J., Klein H.L., Cowan N.J.Cell 93:863-873 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP, NT (Glial Fibrillary Acidic Protein)
G2037-09B 200 µL

GFAP, NT (Glial Fibrillary Acidic Protein)

Sign In for Pricing
View Details
ARHGAP1 shRNA Plasmid (h)
sc-96477-SH 20 µg

ARHGAP1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human NFU1 shRNA (UAS) - Lentiviral human NFU1 shRNA (UAS, iRFP) (100)
GTR15352482 1 Vial

Lentiviral human NFU1 shRNA (UAS) - Lentiviral human NFU1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Beta-defensin 1
orb1642336-01 50 µg

Beta-defensin 1

Sign In for Pricing
View Details
Beta-defensin 1
orb1642336-02 100 µg

Beta-defensin 1

Sign In for Pricing
View Details
Beta-defensin 1
orb1642336-03 1 mg

Beta-defensin 1

Sign In for Pricing
View Details