Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial

Product Specifications

Product Name Alternative

Macropain chain Z; Multicatalytic endopeptidase complex chain Z; Proteasome subunit Z

Abbreviation

Recombinant Human PSMB7 protein, partial

Gene Name

PSMB7

UniProt

Q99436

Expression Region

44-275aa

Organism

Homo sapiens (Human)

Target Sequence

TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMD

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex) . Within the 20S core complex, PSMB7 displays a trypsin-like activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex) . Inhibits the transactivation function of HIF-1A under both normoxic and hypoxia-mimicking conditions. The interaction with EMAP2 increases the proteasome-mediated HIF-1A degradation under the hypoxic conditions. Plays a role in hepatitis C virus internal ribosome entry site-mediated translation. Mediates nuclear translocation of the androgen receptor (AR) and thereby enhances androgen-mediated transactivation. Promotes MAVS degradation and thereby negatively regulates MAVS-mediated innate immune response.

Molecular Weight

52.6 kDa

References & Citations

Newly identified pair of proteasomal subunits regulated reciprocally by interferon gamma." Hisamatsu H., Shimbara N., Saito Y., Kristensen P., Hendil K.B., Fujiwara T., Takahashi E., Tanahashi N., Tamura T., Ichihara A., Tanaka K. J. Exp. Med. 183:1807-1816 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)
MBS2163873-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)

Ask
View Details
APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)
MBS2163873-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)

Ask
View Details
APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)
MBS2163873-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)

Ask
View Details
APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)
MBS2163873-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)

Ask
View Details
APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)
MBS2163873-05 5 mL

APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)

Ask
View Details
APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)
MBS2163873-06 5x 5 mL

APC_Cy7-Linked Monoclonal Antibody to Beta Catenin (beta-catenin)

Ask
View Details