Recombinant Human Dynein light chain 1, Cytoplasmic domain (DYNLL1)
Product Specifications
Product Name Alternative
8KDA dynein light chain ; DLC8Dynein light chain LC8-type 1; Protein inhibitor of neuronal nitric oxide synthase ; PIN
Abbreviation
Recombinant Human DYNLL1 protein
Gene Name
DYNLL1
UniProt
P63167
Expression Region
1-89aa
Organism
Homo sapiens (Human)
Target Sequence
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Tag
N-terminal GST-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Apoptosis
Relevance
Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from Cytoplasmic domain dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.; FUNCTION
Molecular Weight
37.4 kDa
References & Citations
Biochemical and structural characterization of the Pak1-LC8 interaction.Lightcap C.M., Sun S., Lear J.D., Rodeck U., Polenova T., Williams J.C.J. Biol. Chem. 283:27314-27324 (2008)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items