Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ADP-ribosylation factor 5 (ARF5)

Product Specifications

Product Name Alternative

ADP ribosylation factor 5; ADP-ribosylation factor 5; ARF 5; Arf5; ARF5_HUMAN

Abbreviation

Recombinant Human ARF5 protein

Gene Name

ARF5

UniProt

P84085

Expression Region

2-180aa

Organism

Homo sapiens (Human)

Target Sequence

GLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Molecular Weight

47.4 kDa

References & Citations

Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells.Tsuchiya M., Price S.R., Tsai S.-C., Moss J., Vaughan M.J. Biol. Chem. 266:2772-2777 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAN2B2 CRISPR Activation Plasmid (h)
sc-411715-ACT 20 µg

MAN2B2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
cIAP-1/HIAP-2 Overexpression Lysate (Denatured) - (Dry Ice)
H00000329-T02 0.1 mL

cIAP-1/HIAP-2 Overexpression Lysate (Denatured) - (Dry Ice)

Sign In for Pricing
View Details
Glycoprotein Ib antibody
70R-6193 100 µL

Glycoprotein Ib antibody

Sign In for Pricing
View Details
Active Proteinase K (PROK)
TRV-0005782-01 10 µg

Active Proteinase K (PROK)

Sign In for Pricing
View Details
Active Proteinase K (PROK)
TRV-0005782-02 50 µg

Active Proteinase K (PROK)

Sign In for Pricing
View Details
Active Proteinase K (PROK)
TRV-0005782-03 100 µg

Active Proteinase K (PROK)

Sign In for Pricing
View Details