Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Active regulator of SIRT1 protein (RPS19BP1)

Product Specifications

Product Name Alternative

40S ribosomal protein S19-binding protein 1 Short name: RPS19-binding protein 1 Short name: S19BP

Abbreviation

Recombinant Human AROS protein

Gene Name

AROS

UniProt

Q86WX3

Expression Region

1-145aa

Organism

Homo sapiens (Human)

Target Sequence

MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.4 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEOX2 Protein Vector (Human) (pPM-C-His)
PV025560 500 ng

MEOX2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FCH Domain Only 2 (FCHO2) Antibody (HRP)
abx315421-01 20 µg

FCH Domain Only 2 (FCHO2) Antibody (HRP)

Sign In for Pricing
View Details
FCH Domain Only 2 (FCHO2) Antibody (HRP)
abx315421-02 50 µg

FCH Domain Only 2 (FCHO2) Antibody (HRP)

Sign In for Pricing
View Details
FCH Domain Only 2 (FCHO2) Antibody (HRP)
abx315421-03 100 µg

FCH Domain Only 2 (FCHO2) Antibody (HRP)

Sign In for Pricing
View Details
FCH Domain Only 2 (FCHO2) Antibody (HRP)
abx315421-04 200 µg

FCH Domain Only 2 (FCHO2) Antibody (HRP)

Sign In for Pricing
View Details
FCH Domain Only 2 (FCHO2) Antibody (HRP)
abx315421-05 1 mg

FCH Domain Only 2 (FCHO2) Antibody (HRP)

Sign In for Pricing
View Details