Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat shock factor-binding protein 1 (HSBP1), partial

Product Specifications

Product Name Alternative

Nasopharyngeal carcinoma-associated antigen 13 ; NPC-A-13

Abbreviation

Recombinant Human HSBP1 protein, partial

Gene Name

HSBP1

UniProt

O75506

Expression Region

1-75aa

Organism

Homo sapiens (Human)

Target Sequence

MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

Molecular Weight

35.5 kDa

References & Citations

A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLCO2B1 Antibody : HRP (OABF01364-HRP)
OABF01364-HRP 100 µL

SLCO2B1 Antibody : HRP (OABF01364-HRP)

Sign In for Pricing
View Details
Human IFN b 1a Protein
orb80387-01 5 µg

Human IFN b 1a Protein

Sign In for Pricing
View Details
Human IFN b 1a Protein
orb80387-02 20 µg

Human IFN b 1a Protein

Sign In for Pricing
View Details
Human IFN b 1a Protein
orb80387-03 1 mg

Human IFN b 1a Protein

Sign In for Pricing
View Details
GDF3 Antibody (YA1965, Rabbit)
HY-P82220-01 10 µL

GDF3 Antibody (YA1965, Rabbit)

Sign In for Pricing
View Details
GDF3 Antibody (YA1965, Rabbit)
HY-P82220-02 50 μL

GDF3 Antibody (YA1965, Rabbit)

Sign In for Pricing
View Details