Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat shock factor-binding protein 1 (HSBP1), partial

Product Specifications

Product Name Alternative

Nasopharyngeal carcinoma-associated antigen 13 ; NPC-A-13

Abbreviation

Recombinant Human HSBP1 protein, partial

Gene Name

HSBP1

UniProt

O75506

Expression Region

1-75aa

Organism

Homo sapiens (Human)

Target Sequence

MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

Molecular Weight

35.5 kDa

References & Citations

A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 3 beta (MIP-3-beta, MIP3B, MIP-3b, Beta Chemokine Exodus-3, C-C Motif Chemokine 19, Chemokine (C-C Motif) Ligand 19, CCL19, CK beta-11, CKb11, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1 Ligand Chemokine, E
MBS6485996-01 0.1 mL

Macrophage Inflammatory Protein 3 beta (MIP-3-beta, MIP3B, MIP-3b, Beta Chemokine Exodus-3, C-C Motif Chemokine 19, Chemokine (C-C Motif) Ligand 19, CCL19, CK beta-11, CKb11, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1 Ligand Chemokine, E

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 beta (MIP-3-beta, MIP3B, MIP-3b, Beta Chemokine Exodus-3, C-C Motif Chemokine 19, Chemokine (C-C Motif) Ligand 19, CCL19, CK beta-11, CKb11, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1 Ligand Chemokine, E
MBS6485996-02 5x 0.1 mL

Macrophage Inflammatory Protein 3 beta (MIP-3-beta, MIP3B, MIP-3b, Beta Chemokine Exodus-3, C-C Motif Chemokine 19, Chemokine (C-C Motif) Ligand 19, CCL19, CK beta-11, CKb11, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1 Ligand Chemokine, E

Sign In for Pricing
View Details
Endo G Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61741R-APC-Cy5.5 100 µL

Endo G Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Nuclear Fast Red
orb2652924 50 mL

Nuclear Fast Red

Sign In for Pricing
View Details
NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (MaxLight 490)
249312-ML490 100 µL

NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0042 nucleotide-binding protein VFMJ11_0375 (VFMJ11_0375)
MBS1220678-01 0.02 mg (E-Coli)

Recombinant Vibrio fischeri UPF0042 nucleotide-binding protein VFMJ11_0375 (VFMJ11_0375)

Sign In for Pricing
View Details