Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide Va

Abbreviation

Recombinant Human COX5A protein

Gene Name

COX5A

UniProt

P20674

Expression Region

42-150aa

Organism

Homo sapiens (Human)

Target Sequence

SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

This is the he A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Molecular Weight

39.5 kDa

References & Citations

Molecular evolution of the cytochrome c oxidase subunit 5A gene in primates.Uddin M., Opazo J.C., Wildman D.E., Sherwood C.C., Hof P.R., Goodman M., Grossman L.I.BMC Evol. Biol. 8:8-8 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + KRT7/903), CF647 conjugate, 0.1mg/mL
BNC470906-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + KRT7/903), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF488A conjugate, 0.1mg/mL
BNC881462-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF488A conjugate, 0.1mg/mL
BNC882056-100 1x 100 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF740 conjugate, 0.1mg/mL
BNC741983-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details