Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 13B protein (TNFSF13B), partial

Product Specifications

Product Name Alternative

B lymphocyte stimulator ; BLySB-cell-activating factorBAFFDendritic cell-derived TNF-like moleculeTNF- and APOL-related leukocyte expressed ligand 1 ; TALL-1; CD257

Abbreviation

Recombinant Human TNFSF13B protein, partial

Gene Name

TNFSF13B

UniProt

Q9Y275

Expression Region

68-285aa

Organism

Homo sapiens (Human)

Target Sequence

QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.

Molecular Weight

39.7 kDa

References & Citations

TALL-1 is a novel member of the TNF family that is down-regulated by mitogens.Shu H.-B., Hu W.-H., Johnson H.J. Leukoc. Biol. 65:680-683 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA5, CT (IFNA5, Interferon alpha-5, Interferon alpha-61, Interferon alpha-G) (Azide free) (HRP) discontinued
036889-HRP 200 µL

IFNA5, CT (IFNA5, Interferon alpha-5, Interferon alpha-61, Interferon alpha-G) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
C4orf23 Double Nickase Plasmid (h2)
sc-414726-NIC-2 20 µg

C4orf23 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) APC
MBS6136809-01 0.1 mL

GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) APC

Sign In for Pricing
View Details
GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) APC
MBS6136809-02 5x 0.1 mL

GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) APC

Sign In for Pricing
View Details
HENMT1 Human shRNA Lentiviral Particle (Locus ID 113802)
TL306000V 500 µL Each

HENMT1 Human shRNA Lentiviral Particle (Locus ID 113802)

Sign In for Pricing
View Details
CD5 antibody (biotin)
61R-1458 100 ug

CD5 antibody (biotin)

Sign In for Pricing
View Details