Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ER membrane protein complex subunit 9 (EMC9)

Product Specifications

Product Name Alternative

Protein FAM158A

Abbreviation

Recombinant Human EMC9 protein

Gene Name

EMC9

UniProt

Q9Y3B6

Expression Region

1-208aa

Organism

Homo sapiens (Human)

Target Sequence

MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.1 kDa

References & Citations

Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep T Cell Receptor GammaDelta (TCRGD) ELISA Kit
MBS9938922-01 48 Well

Sheep T Cell Receptor GammaDelta (TCRGD) ELISA Kit

Sign In for Pricing
View Details
Sheep T Cell Receptor GammaDelta (TCRGD) ELISA Kit
MBS9938922-02 96 Well

Sheep T Cell Receptor GammaDelta (TCRGD) ELISA Kit

Sign In for Pricing
View Details
Sheep T Cell Receptor GammaDelta (TCRGD) ELISA Kit
MBS9938922-03 5x 96 Well

Sheep T Cell Receptor GammaDelta (TCRGD) ELISA Kit

Sign In for Pricing
View Details
Sheep T Cell Receptor GammaDelta (TCRGD) ELISA Kit
MBS9938922-04 10x 96 Well

Sheep T Cell Receptor GammaDelta (TCRGD) ELISA Kit

Sign In for Pricing
View Details
Anti-N Protein Polyclonal Antibody
PVV00801 100 μg

Anti-N Protein Polyclonal Antibody

Sign In for Pricing
View Details
1,7-Naphthyridine-3-carboxylic acid
AKA67449-01 50 mg

1,7-Naphthyridine-3-carboxylic acid

Sign In for Pricing
View Details