Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Talin-2 (TLN2), partial

Product Specifications

Product Name Alternative

DKFZp451B1011; DKFZp686I0976; DKFZp686K0979; ILWEQ; KIAA0320; Talin-2; talin2; TLN 2; TLN2; TLN2_HUMAN

Abbreviation

Recombinant Human TLN2 protein, partial

Gene Name

TLN2

UniProt

Q9Y4G6

Expression Region

88-406aa

Organism

Homo sapiens (Human)

Target Sequence

RPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity (By similarity) .

Molecular Weight

53.1 kDa

References & Citations

Recruitment and regulation of phosphatidylinositol phosphate kinase type 1 gamma by the FERM domain of talin.Di Paolo G., Pellegrini L., Letinic K., Cestra G., Zoncu R., Voronov S., Chang S., Guo J., Wenk M.R., De Camilli P.Nature 420:85-89 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Semaphorin-6C (SEMA6C), partial
MBS1341607-01 0.5 mg (E-Coli)

Recombinant Human Semaphorin-6C (SEMA6C), partial

Sign In for Pricing
View Details
Recombinant Human Semaphorin-6C (SEMA6C), partial
MBS1341607-02 0.05 mg (Baculovirus)

Recombinant Human Semaphorin-6C (SEMA6C), partial

Sign In for Pricing
View Details
Recombinant Human Semaphorin-6C (SEMA6C), partial
MBS1341607-03 0.5 mg (Yeast)

Recombinant Human Semaphorin-6C (SEMA6C), partial

Sign In for Pricing
View Details
Recombinant Human Semaphorin-6C (SEMA6C), partial
MBS1341607-04 0.05 mg (Mammalian-Cell)

Recombinant Human Semaphorin-6C (SEMA6C), partial

Sign In for Pricing
View Details
Recombinant Human Semaphorin-6C (SEMA6C), partial
MBS1341607-05 1 mg (E-Coli)

Recombinant Human Semaphorin-6C (SEMA6C), partial

Sign In for Pricing
View Details
Recombinant Human Semaphorin-6C (SEMA6C), partial
MBS1341607-06 0.1 mg (Baculovirus)

Recombinant Human Semaphorin-6C (SEMA6C), partial

Sign In for Pricing
View Details